Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSF1R, Mouse (HEK293, Fc)

The CSF1R protein is a tyrosine protein kinase receptor for CSF1 and IL34 and plays a critical regulatory role in hematopoietic cells, especially mononuclear phagocytes. Its effects span innate immunity, inflammation, osteoclast function, skeletal development, and fertility. CSF1R Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CSF1R protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CSF1R Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/csf1r-protein-mouse-511a-a-hek293-fc.html

Purity

96.00

Smiles

MELGPPLVLLLATVWHGQGAPVIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGDTKLEIPLNSDFQDNYYKKVRALSLNAVDFQDAGIYSCVASNDVGTRTATMNFQVVESAYLNLTSEQSLLQEVSVGDSLILTVHADAYPSIQHYNWTYLGPFFEDQRKLEFITQRAIYRYTFKLFLNRVKASEAGQYFLMAQNKAGWNNLTFELTLRYPPEVSVTWMPVNGSDVLFCDVSGYPQPSVTWMECRGHTDRCDEAQALQVWNDTHPEVLSQKPFDKVIIQSQLPIGTLKHNMTYFCKTHNSVGNSSQYFRAVSLGQSKQLPDES

Molecular Formula

12978 (Gene_ID) P09581 (A20-S511) (Accession)

Molecular Weight

Approximately 81.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAEL Human Gene Knockout Kit (CRISPR)
KN405954 1 Kit

MAEL Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Sheep Vascular Cell Adhesion Molecule 1 (VCAM1) ELISA Kit
orb2667314-01 48 Tests

Sheep Vascular Cell Adhesion Molecule 1 (VCAM1) ELISA Kit

Sign In for Pricing
View Details
Sheep Vascular Cell Adhesion Molecule 1 (VCAM1) ELISA Kit
orb2667314-02 96 Tests

Sheep Vascular Cell Adhesion Molecule 1 (VCAM1) ELISA Kit

Sign In for Pricing
View Details
PI3 Kinase p110 beta Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-10657R-PE-Cy5.5 100 µL

PI3 Kinase p110 beta Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
JAM2 Antibody (N-term) Blocking Peptide
MBS9220566-01 0.5 mg

JAM2 Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details
JAM2 Antibody (N-term) Blocking Peptide
MBS9220566-02 5x 0.5 mg

JAM2 Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details