Human TNFSF14 protein
This Human TNFSF14 protein spans the amino acid sequence from region 74-240aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
(Herpes virus entry mediator ligand) (HVEM-L) (Herpesvirus entry mediator ligand) (CD258) (HVEML) (LIGHT) (UNQ391) (PRO726)
UniProt
O43557
Expression Region
74-240aa
Tag
N-terminal hFC-Myc-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 85% as determined by SDS-PAGE.
Bioactivity
1Measured by its binding ability in a functional ELISA. Immobilized TNFRSF14 at 5 μg/ml can bind TNFSF14, the EC50 is 45.44-53.29 ng/ml.
Form
Lyophilized powder
Molecular Weight
46.7 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
AA Sequence
DGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RR211258L4V 200 µL
Nol12 (NM_001012747) Rat Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 
149247 50 µg
Influenza A, H1N1, Hemagglutinin, Control Peptide (H1N1/HA)
Sign In for Pricing
View Details LV778383 1.0 µg DNA
RPL23AP17 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
Sign In for Pricing
View Details K1001406 1.0 µg DNA
HSPD1P9 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
Sign In for Pricing
View Details