Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TNFSF14 protein

This Human TNFSF14 protein spans the amino acid sequence from region 74-240aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Herpes virus entry mediator ligand) (HVEM-L) (Herpesvirus entry mediator ligand) (CD258) (HVEML) (LIGHT) (UNQ391) (PRO726)

UniProt

O43557

Expression Region

74-240aa

Tag

N-terminal hFC-Myc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 85% as determined by SDS-PAGE.

Bioactivity

1Measured by its binding ability in a functional ELISA. Immobilized TNFRSF14 at 5 μg/ml can bind TNFSF14, the EC50 is 45.44-53.29 ng/ml.

Form

Lyophilized powder

Molecular Weight

46.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

DGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nol12 (NM_001012747) Rat Tagged ORF Clone Lentiviral Particle
RR211258L4V 200 µL

Nol12 (NM_001012747) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Influenza A, H1N1, Hemagglutinin, Control Peptide (H1N1/HA)
149247 50 µg

Influenza A, H1N1, Hemagglutinin, Control Peptide (H1N1/HA)

Sign In for Pricing
View Details
RPL23AP17 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV778383 1.0 µg DNA

RPL23AP17 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
HSPD1P9 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1001406 1.0 µg DNA

HSPD1P9 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
ALY Polyclonal Antibody
BT-AP00395-01 20 µL

ALY Polyclonal Antibody

Sign In for Pricing
View Details
ALY Polyclonal Antibody
BT-AP00395-02 50 µL

ALY Polyclonal Antibody

Sign In for Pricing
View Details