Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RBP4 protein

This Human RBP4 protein spans the amino acid sequence from region 19-201aa. Purity: Greater than 94% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Plasma retinol-binding protein) (PRBP) (RBP)

UniProt

P02753

Expression Region

19-201aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 94% as determined by SDS-PAGE.

Bioactivity

1Measured by its binding ability in a functional ELISA. Immobilized RBP4 at 5 μg/ml can bind TTR, the EC50 is 695.0-970.1 ng/ml.

Form

Lyophilized powder

Molecular Weight

50 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C8orf42 Over-expression Lysate Product
GWB-49F0B9 0.1 mg

C8orf42 Over-expression Lysate Product

Sign In for Pricing
View Details
Recombinant Staphylococcus Aureus UPF0346 protein in crr 3'region Protein (aa 1-73)
VAng-Cr6488-50gEcoli 50 µg (E. coli)

Recombinant Staphylococcus Aureus UPF0346 protein in crr 3'region Protein (aa 1-73)

Sign In for Pricing
View Details
Lentiviral human LETM2 shRNA (UAS) - Lentiviral human LETM2 shRNA (UAS, RFP) (100)
GTR15132072 1 Vial

Lentiviral human LETM2 shRNA (UAS) - Lentiviral human LETM2 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
ITIH4 (NM_001166449) Human Tagged ORF Clone
RC230577 10 µg

ITIH4 (NM_001166449) Human Tagged ORF Clone

Sign In for Pricing
View Details
Abeta Fibrillization modulator 1
MBS5816158 Inquire

Abeta Fibrillization modulator 1

Sign In for Pricing
View Details
Human Soluble Tumor Necrosis Factor Receptor 1 (STNF-R1) ELISA Kit
MBS3800952-01 48 Well

Human Soluble Tumor Necrosis Factor Receptor 1 (STNF-R1) ELISA Kit

Sign In for Pricing
View Details