Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RBP4 protein

This Human RBP4 protein spans the amino acid sequence from region 19-201aa. Purity: Greater than 94% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Plasma retinol-binding protein) (PRBP) (RBP)

UniProt

P02753

Expression Region

19-201aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 94% as determined by SDS-PAGE.

Bioactivity

1Measured by its binding ability in a functional ELISA. Immobilized RBP4 at 5 μg/ml can bind TTR, the EC50 is 695.0-970.1 ng/ml.

Form

Lyophilized powder

Molecular Weight

50 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat High Density Lipoprotein (HDL) ELISA Kit
RD-HDL-Ra-96Tests 96 Tests

Rat High Density Lipoprotein (HDL) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal Cytokeratin 15 Antibody (KRT15/2959)
NBP3-07620-20ug 20 µg

Mouse Monoclonal Cytokeratin 15 Antibody (KRT15/2959)

Sign In for Pricing
View Details
AGPS Polyclonal Antibody, FITC Conjugated
bs-12462R-FITC 100 µL

AGPS Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
NAMPTL Protein Lysate (Human) with C-Ha Tag
31415031 100 µg

NAMPTL Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
TUBGCP4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
48833111 3x 1.0 µg

TUBGCP4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
QRFP Receptor AQ27 (401-433) / SP9155 (401-433) (Mouse) - FAM Labeled Purified IgG
FG-G-001-81A 100 µL

QRFP Receptor AQ27 (401-433) / SP9155 (401-433) (Mouse) - FAM Labeled Purified IgG

Sign In for Pricing
View Details