Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CD47 protein

This Human CD47 protein spans the amino acid sequence from region 19-139aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Antigenic surface determinant protein OA3 (Integrin-associated protein) (IAP) (Protein MER6) (CD47)

UniProt

Q08722

Expression Region

19-139aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Cell Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

1Measured by its binding ability in a functional ELISA. Immobilized SIRPA at 2 μg/ml can bind human CD47, the EC50 of human CD47 protein is 65.91-82.42 ng/ml. 2Human SIRPA protein His/Myc tag captured on COOH chip can bind Human CD47 protein Fc tag with an affinity constant of 19.1 nM as detected by LSPR Assay.

Form

Lyophilized powder

Molecular Weight

41.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse/Rat CD31/PECAM-1 Alexa Fluor 488 Affinity Purified PAb
FAB3628G-025 25 Tests

Mouse/Rat CD31/PECAM-1 Alexa Fluor 488 Affinity Purified PAb

Sign In for Pricing
View Details
NEIL1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
31696111 3x 1.0 µg

NEIL1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
3-(Pyridin-2-yl)propiolic Acid
TRC-P841028-50MG 50 mg

3-(Pyridin-2-yl)propiolic Acid

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Interleukin 15 (IL15)
MBS2143812-01 0.1 mL

Biotin-Linked Monoclonal Antibody to Interleukin 15 (IL15)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Interleukin 15 (IL15)
MBS2143812-02 0.2 mL

Biotin-Linked Monoclonal Antibody to Interleukin 15 (IL15)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Interleukin 15 (IL15)
MBS2143812-03 0.5 mL

Biotin-Linked Monoclonal Antibody to Interleukin 15 (IL15)

Sign In for Pricing
View Details