Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GHR protein

This Human GHR protein spans the amino acid sequence from region 27-264aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Somatotropin receptor (Serum-binding protein)

UniProt

P10912

Expression Region

27-264aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Bioactivity

1Measured by its binding ability in a functional ELISA. Immobilized GH1 at 1 μg/ml can bind human GHR, the EC50 of human GHR protein is 24.96-33.39 ng/ml. 2Human GH1 protein his/myc tag captured on COOH chip can bind Human GHR protein Fc tag with an affinity constant of 6.1 nM as detected by LSPR Assay.

Form

Lyophilized powder

Molecular Weight

58.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

AILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MAdCAM1 Antibody , Cy3 Conjugate
A04227-2-Cy3 100 µg/Vial

Anti-MAdCAM1 Antibody , Cy3 Conjugate

Sign In for Pricing
View Details
SFTPC Antibody, HRP conjugated
CSB-PA021174LB01BO-01 50 µg

SFTPC Antibody, HRP conjugated

Sign In for Pricing
View Details
SFTPC Antibody, HRP conjugated
CSB-PA021174LB01BO-02 100 µg

SFTPC Antibody, HRP conjugated

Sign In for Pricing
View Details
SOCS2 (Suppressors Of Cytokine Signaling 2, CIS2, Cish2, SOCS-2, SSI-2, SSI2, STATI2, Cytokine-inducible SH2 protein 2, STAT-induced STAT inhibitor 2)
365119 200 µL

SOCS2 (Suppressors Of Cytokine Signaling 2, CIS2, Cish2, SOCS-2, SSI-2, SSI2, STATI2, Cytokine-inducible SH2 protein 2, STAT-induced STAT inhibitor 2)

Sign In for Pricing
View Details
GZMM Protein Vector (Mouse) (pPM-C-HA)
PV187516 500 ng

GZMM Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Human Zinc finger CCCH domain-containing protein 15, ZC3H15 ELISA Kit
MBS9307076-01 48 Well

Human Zinc finger CCCH domain-containing protein 15, ZC3H15 ELISA Kit

Sign In for Pricing
View Details