Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SINHCAF protein

This Human SINHCAF protein spans the amino acid sequence from region 1-221aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein FAM60A (Tera protein homolog) (C12orf14) (FAM60A)

UniProt

Q9NP50

Expression Region

1-221aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized LCN2 at 2 μg/ml can bind human SINHCAF, the EC50 of human SINHCAF protein is 31.54-38.59 μg/ml.

Form

Liquid or Lyophilized powder

Molecular Weight

51.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MFGFHKPKMYRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLHETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRIKSNQISKLQKEFKRHNSDAHSTTSSASPAQSPCYSNQSDDGSDTEMASGSNRTPVFSFLDLTYWKRQKICCGIIYKGRFGEVLIDTHLFKPCCSNKKAAAEKPEEQGPEPLPISTQEW

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RSL1D1 (G-4)
sc-376974 200 µg/mL

RSL1D1 (G-4)

Sign In for Pricing
View Details
Vdac3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7022007 1.0 µg DNA

Vdac3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Phospho-TPH2 (Ser19) Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2492645 100 µL

Phospho-TPH2 (Ser19) Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
Fluor® 647 Anti-Mouse MHC II (I-A/I-E) Antibody[M5/114]
FCE1371-01 25 µg

Fluor® 647 Anti-Mouse MHC II (I-A/I-E) Antibody[M5/114]

Sign In for Pricing
View Details
Fluor® 647 Anti-Mouse MHC II (I-A/I-E) Antibody[M5/114]
FCE1371-02 100 µg

Fluor® 647 Anti-Mouse MHC II (I-A/I-E) Antibody[M5/114]

Sign In for Pricing
View Details
Matrix Protein M1 (58-66) (Influenza A virus)
H-7744.0500 0.5mg

Matrix Protein M1 (58-66) (Influenza A virus)

Sign In for Pricing
View Details