Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SINHCAF protein

This Human SINHCAF protein spans the amino acid sequence from region 1-221aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein FAM60A (Tera protein homolog) (C12orf14) (FAM60A)

UniProt

Q9NP50

Expression Region

1-221aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized LCN2 at 2 μg/ml can bind human SINHCAF, the EC50 of human SINHCAF protein is 31.54-38.59 μg/ml.

Form

Liquid or Lyophilized powder

Molecular Weight

51.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MFGFHKPKMYRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLHETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRIKSNQISKLQKEFKRHNSDAHSTTSSASPAQSPCYSNQSDDGSDTEMASGSNRTPVFSFLDLTYWKRQKICCGIIYKGRFGEVLIDTHLFKPCCSNKKAAAEKPEEQGPEPLPISTQEW

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PYGL Polyclonal Antibody, FITC Conjugated
A53438-050 50 µL

PYGL Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Rat Anti-Mouse CD4/PE-Cy5.5 antibody
BF40035-01 50 Tests

Rat Anti-Mouse CD4/PE-Cy5.5 antibody

Sign In for Pricing
View Details
Rat Anti-Mouse CD4/PE-Cy5.5 antibody
BF40035-02 100 Tests

Rat Anti-Mouse CD4/PE-Cy5.5 antibody

Sign In for Pricing
View Details
ACTA2 Antibody
orb389031-01 20 µg

ACTA2 Antibody

Sign In for Pricing
View Details
ACTA2 Antibody
orb389031-02 100 µg

ACTA2 Antibody

Sign In for Pricing
View Details
ACTA2 Antibody
orb389031-03 100 ug (without BSA and Azide)

ACTA2 Antibody

Sign In for Pricing
View Details