Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli YTFE protein

This E. coli YTFE protein spans the amino acid sequence from region 1-220aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Regulator of cell morphogenesis and NO signaling

UniProt

P69506

Expression Region

1-220aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized aqpZ at 5 μg/ml can bind E.coli ytfE, the EC50 of E.coli ytfE protein is 197.90-259.70 μg/ml.

Form

Liquid or Lyophilized powder

Molecular Weight

51.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEVIEAELAKLAEQPIEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYLTMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTPPPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEP290 Rabbit Polyclonal Antibody (Biotin)
orb449631 100 µL

CEP290 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Rabbit Polyclonal Serpin A7/TBG Antibody [Alexa Fluor 750]
NBP2-99678AF750 0.1 mL

Rabbit Polyclonal Serpin A7/TBG Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details
CTNND1 (NM_001085458) Human Recombinant Protein
PH34142M5 20 µg

CTNND1 (NM_001085458) Human Recombinant Protein

Sign In for Pricing
View Details
Rabbit Polyclonal ODAM Antibody
NBP3-21260-25ul 25 µL

Rabbit Polyclonal ODAM Antibody

Sign In for Pricing
View Details
Medicagenic acid
FM65805-01 2 mg

Medicagenic acid

Sign In for Pricing
View Details
Medicagenic acid
FM65805-02 5 mg

Medicagenic acid

Sign In for Pricing
View Details