Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BZW2 protein

This Human BZW2 protein spans the amino acid sequence from region 1-419aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q9Y6E2

Expression Region

1-419aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized OMA1 at 5 μg/ml can bind human BZW2, the EC50 of human BZM2 is 45.42-72.22 μg/ml.

Form

Liquid or Lyophilized powder

Molecular Weight

75.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLDYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIRRYKYLEKAFEDEMKKLLLFLKAFSETEQTKLAMLSGILLGNGTLPATILTSLFTDSLVKEGIAASFAVKLFKAWMAEKDANSVTSSLRKANLDKRLLELFPVNRQSVDHFAKYFTDAGLKELSDFLRVQQSLGTRKELQKELQERLSQECPIKEVVLYVKEEMKRNDLPETAVIGLLWTCIMNAVEWNKKEELVAEQALKHLKQYAPLLAVFSSQGQSELILLQKVQEYCYDNIHFMKAFQKIVVLFYKADVLSEEAILKWYKEAHVAKGKSVFLDQMKKFVEWLQNAEEESESEGEEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti Human TSC22D1  Monoclonal Antibody
MBS2544388-01 0.06 mL

Rabbit anti Human TSC22D1  Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit anti Human TSC22D1  Monoclonal Antibody
MBS2544388-02 0.12 mL

Rabbit anti Human TSC22D1  Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit anti Human TSC22D1  Monoclonal Antibody
MBS2544388-03 0.2 mL

Rabbit anti Human TSC22D1  Monoclonal Antibody

Sign In for Pricing
View Details
UVSSA Antibody (HRP)
orb517225-01 50 µg

UVSSA Antibody (HRP)

Sign In for Pricing
View Details
UVSSA Antibody (HRP)
orb517225-02 100 µg

UVSSA Antibody (HRP)

Sign In for Pricing
View Details
Rabbit Anti Human CXCR4 Monoclonal Clone CID-3 100ug
IRBAHUCXCR4CID3C100ug 100 µg

Rabbit Anti Human CXCR4 Monoclonal Clone CID-3 100ug

Sign In for Pricing
View Details