Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GDF7 protein

This Human GDF7 protein spans the amino acid sequence from region 322-450aa. Purity: > 95 % as determined by SDS-PAGE and HPLC analyses.

Product Specifications

Product Name Alternative

GDF-7, BMP12

UniProt

Q7Z4P5

Expression Region

322-450aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Less than 0.1 EU/μg as determined by LAL method.

Purity

> 95 % as determined by SDS-PAGE and HPLC analyses.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by inducing alkaline phosphatase production of murine ATDC5 cells is less than 1.0 μg/ml, corresponding to a specific activity of > 1000 IU/mg.

Form

Lyophilized powder

Molecular Weight

14.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA.

AA Sequence

TALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKELGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spark UV™ 387 anti-human IFN-γ
GT18219 25 Tests

Spark UV™ 387 anti-human IFN-γ

Sign In for Pricing
View Details
GPR17 (NM_005291) Human Tagged Lenti ORF Clone
RC223875L3 10 µg

GPR17 (NM_005291) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Arachidonic acid
C21510-25ul 25 µL

Arachidonic acid

Sign In for Pricing
View Details
Fam69b sgRNA CRISPR Lentivector set (Rat)
K7200401 3x 1.0 µg

Fam69b sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Hsa-miR-3116 miRNA Agomir
CMJ0894-01 5 nmol

Hsa-miR-3116 miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-3116 miRNA Agomir
CMJ0894-02 10 nmol

Hsa-miR-3116 miRNA Agomir

Sign In for Pricing
View Details