Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GDF7 protein

This Human GDF7 protein spans the amino acid sequence from region 322-450aa. Purity: > 95 % as determined by SDS-PAGE and HPLC analyses.

Product Specifications

Product Name Alternative

GDF-7, BMP12

UniProt

Q7Z4P5

Expression Region

322-450aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Less than 0.1 EU/μg as determined by LAL method.

Purity

> 95 % as determined by SDS-PAGE and HPLC analyses.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by inducing alkaline phosphatase production of murine ATDC5 cells is less than 1.0 μg/ml, corresponding to a specific activity of > 1000 IU/mg.

Form

Lyophilized powder

Molecular Weight

14.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA.

AA Sequence

TALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKELGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ANKRD27 Antibody [Alexa Fluor 594]
NBP2-82072AF594 0.1 mL

Rabbit Polyclonal ANKRD27 Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
Mouse NHLRC1 siRNA
abx925880-01 15 nmol

Mouse NHLRC1 siRNA

Sign In for Pricing
View Details
Mouse NHLRC1 siRNA
abx925880-02 30 nmol

Mouse NHLRC1 siRNA

Sign In for Pricing
View Details
Mouse Monoclonal TMIGD2 Antibody (953730) [PE/Cy5.5]
MAB83161PECY55 0.1 mL

Mouse Monoclonal TMIGD2 Antibody (953730) [PE/Cy5.5]

Sign In for Pricing
View Details
Mouse Monoclonal CD42b/GPIb alpha Antibody (AK2) [Janelia Fluor 646]
NB100-63790JF646 0.1 mL

Mouse Monoclonal CD42b/GPIb alpha Antibody (AK2) [Janelia Fluor 646]

Sign In for Pricing
View Details
Mouse WD repeat-containing protein 37 (WDR37) ELISA Kit
abx553404 96 Tests

Mouse WD repeat-containing protein 37 (WDR37) ELISA Kit

Sign In for Pricing
View Details