Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Culex quinquefasciatus Submitted name: Odorant binding protein OBP28 protein

This Culex quinquefasciatus Submitted name: Odorant binding protein OBP28 protein spans the amino acid sequence from region 21-150aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

B0XC79

Expression Region

21-150aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Culex quinquefasciatus (Southern house mosquito) (Culex pungens)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DEASDKEQAKEQAKQMLRSMTQKCKEAEGASDDDVEAMIDDVMPESQVQKCFHSCVQQQFGVSDGQKFLQQGFLEIMMMAVGNDEQQQGHAKEVAEECDGVANEDRCQLAVDIMTCVKQGMEKRGMKVDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZPR1 (m) : 293T Lysate
sc-124831 100 µg - 200 µL

ZPR1 (m) : 293T Lysate

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. indica Respiratory burst oxidase homolog protein B (RBOHB), partial
MBS7090279 Inquire

Recombinant Oryza sativa subsp. indica Respiratory burst oxidase homolog protein B (RBOHB), partial

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Caveolin 1 (CAV1)
MBS2039556-01 0.1 mL

PE-Linked Polyclonal Antibody to Caveolin 1 (CAV1)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Caveolin 1 (CAV1)
MBS2039556-02 0.2 mL

PE-Linked Polyclonal Antibody to Caveolin 1 (CAV1)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Caveolin 1 (CAV1)
MBS2039556-03 0.5 mL

PE-Linked Polyclonal Antibody to Caveolin 1 (CAV1)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Caveolin 1 (CAV1)
MBS2039556-04 1 mL

PE-Linked Polyclonal Antibody to Caveolin 1 (CAV1)

Sign In for Pricing
View Details