Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P200 protein

This p200 protein spans the amino acid sequence from region 857-985aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

P200, MPN_567, MP275, Protein P200

UniProt

P75211

Expression Region

857-985aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mycoplasma pneumoniae (strain ATCC 29342 / M129)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LDWELLIGNSNYGHYEPSGEWVWAGYFDDNQIWTPDASVEWARESDYTDLIGDEIYGRYNRKGEWIWYGYYDETGEWVLVDEHYQNHQPRISEAPRFWEQLIGNEDYGYYEDNEWKWYDGEFDSEGNWL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human eosinophil-associated ribonuclease A family member 3 (EAR3) ELISA Kit
QY-E01504 96 Tests

Human eosinophil-associated ribonuclease A family member 3 (EAR3) ELISA Kit

Sign In for Pricing
View Details
PLV3-U6-SREBF1 (human) -shRNA1-Puro
BZ57701 1 Vial

PLV3-U6-SREBF1 (human) -shRNA1-Puro

Sign In for Pricing
View Details
Boc- (±) -trans-4- (4-cyanophenyl) pyrrolidine-3-carboxylic acid
266666-01 25 mg

Boc- (±) -trans-4- (4-cyanophenyl) pyrrolidine-3-carboxylic acid

Sign In for Pricing
View Details
Boc- (±) -trans-4- (4-cyanophenyl) pyrrolidine-3-carboxylic acid
266666-02 50 mg

Boc- (±) -trans-4- (4-cyanophenyl) pyrrolidine-3-carboxylic acid

Sign In for Pricing
View Details
Boc- (±) -trans-4- (4-cyanophenyl) pyrrolidine-3-carboxylic acid
266666-03 100 mg

Boc- (±) -trans-4- (4-cyanophenyl) pyrrolidine-3-carboxylic acid

Sign In for Pricing
View Details
Boc- (±) -trans-4- (4-cyanophenyl) pyrrolidine-3-carboxylic acid
266666-04 250 mg

Boc- (±) -trans-4- (4-cyanophenyl) pyrrolidine-3-carboxylic acid

Sign In for Pricing
View Details