Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CPS1 protein

This Human CPS1 protein spans the amino acid sequence from region 1354-1500aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Carbamoyl-phosphate synthetase I (CPSase I)

UniProt

P31327

Expression Region

1354-1500aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GFKIPQKGILIGIQQSFRPRFLGVAEQLHNEGFKLFATEATSDWLNANNVPATPVAWPSQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYRQYSAGKAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTRB1 Rabbit Polyclonal Antibody (Cy3)
orb986816 100 µL

CTRB1 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Plasmalemma Vesicle Associated Protein (PLVAP), Recombinant, Human, His-Tag
055393-01 10 µg

Plasmalemma Vesicle Associated Protein (PLVAP), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Plasmalemma Vesicle Associated Protein (PLVAP), Recombinant, Human, His-Tag
055393-02 50 µg

Plasmalemma Vesicle Associated Protein (PLVAP), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Plasmalemma Vesicle Associated Protein (PLVAP), Recombinant, Human, His-Tag
055393-03 100 µg

Plasmalemma Vesicle Associated Protein (PLVAP), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Plasmalemma Vesicle Associated Protein (PLVAP), Recombinant, Human, His-Tag
055393-04 200 µg

Plasmalemma Vesicle Associated Protein (PLVAP), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
IgG1-N297A Isotype Control, In Vivo Grade Recombinant Human
587140 1 mg

IgG1-N297A Isotype Control, In Vivo Grade Recombinant Human

Sign In for Pricing
View Details