Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Canine Corynephage omega Diphtheria toxin protein

This Canine Corynephage omega Diphtheria toxin protein spans the amino acid sequence from region 26-218aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NAD (+) --diphthamide ADP-ribosyltransferase

UniProt

P00587

Expression Region

26-218aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Corynephage omega

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GADDVVDSSKSFVMENFSSYHGTKPGYVDSIQKGIQKPKSGTQGNYDDDWKGFYSTDNKYDAAGYSVDNENPLSGKAGGVVKVTYPGLTKVLALKVDNAETIKKELGLSLTEPLMEQVGTEEFIKRFGDGASRVVLSLPFAEGSSSVEYINNWEQAKALSVELEINFETRGKRGQDAMYEYMAQACAGNRVRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR6P1 Antibody
CSB-PA007065-01 50 µg

OR6P1 Antibody

Sign In for Pricing
View Details
OR6P1 Antibody
CSB-PA007065-02 100 µg

OR6P1 Antibody

Sign In for Pricing
View Details
Thiosemicarbazide AR
11912280 100 100 g

Thiosemicarbazide AR

Sign In for Pricing
View Details
Cortactin Rabbit Polyclonal Antibody
orb215055-01 30 µL

Cortactin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cortactin Rabbit Polyclonal Antibody
orb215055-02 50 μL

Cortactin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cortactin Rabbit Polyclonal Antibody
orb215055-03 100 µL

Cortactin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details