Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OmpA protein

This ompA protein spans the amino acid sequence from region 23-394aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

OmpA, omp1B, Major outer membrane porin, serovar B, MOMP

UniProt

P23421

Expression Region

23-394aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Chlamydia trachomatis

Field of Research

Microbiology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LPVGNPAEPSLMIDGILWEGFGGDPCDPCTTWVDAISMRMGYYGDFVFDRVLKTDVNKEFQMGAKPTTTTGNAVAPSTLTARENPAYGRHMQDAEMFTNAACMALNIWDRFDVFCTLGASSGYLKGNSASFNLVGLFGNNENQTKVSNGAFVPNMSLDQSVVELYTDTAFAWSVGARAALWECGCATLGASFQYAQSKPKVEELNVLCNAAEFTINKPKGYVGKELPLDLTAGTDAATGTKDASIDYHEWQASLALSYRLNMFTPYIGVKWSRASFDADTIRIAQPKSAETIFDVTTLNPTIAGAGDVKTSAEGQLGDTMQIVSLQLNKMKSRKSCGIAVGTTIVDADKYAVTVETRLIDERAAHVNAQFRF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H2AX Antibody
orb125840-01 25 µg

Histone H2AX Antibody

Sign In for Pricing
View Details
Histone H2AX Antibody
orb125840-02 50 µg

Histone H2AX Antibody

Sign In for Pricing
View Details
Histone H2AX Antibody
orb125840-03 100 µg

Histone H2AX Antibody

Sign In for Pricing
View Details
Histone H2AX Antibody
orb125840-04 200 µg

Histone H2AX Antibody

Sign In for Pricing
View Details
Methocarbamol
orb1308699-01 1 ml x 10 mM (in DMSO)

Methocarbamol

Sign In for Pricing
View Details
Methocarbamol
orb1308699-02 100 mg

Methocarbamol

Sign In for Pricing
View Details