Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Enterovirus A71 Genome polyprotein protein

This Enterovirus A71 Genome polyprotein protein spans the amino acid sequence from region 1441-1497aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

VP4-VP2 (P1A) (Virion protein 4) (Capsid protein VP2) (P1B) (Virion protein 2) (P1C) (Virion protein 3) (P1D) (Virion protein 1) (Picornain 2A) (Protein 2A) (Protein 3B) (P3B) (3D polymerase) (3Dpol) (Protein 3D)

UniProt

F6KTB0

Expression Region

1441-1497aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Enterovirus A71

Field of Research

Infectious Diseases

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

7.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPPKFKPIKISLEEKPAPDAISDLLASVDSEEVRQYCRDQGWIIPETPTNVERHLNR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eperisone Hydrochloride
TRC-E565800-5G 5 g

Eperisone Hydrochloride

Sign In for Pricing
View Details
Human SETD4 activation kit by CRISPRa
GA110058 1 Kit

Human SETD4 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Slit Homolog 3 (Slit3) ELISA Kit
RDR-Slit3-Mu-01 96 Tests

Mouse Slit Homolog 3 (Slit3) ELISA Kit

Sign In for Pricing
View Details
Mouse Slit Homolog 3 (Slit3) ELISA Kit
RDR-Slit3-Mu-02 48 Tests

Mouse Slit Homolog 3 (Slit3) ELISA Kit

Sign In for Pricing
View Details
KIF3A Polyclonal Antibody
E-AB-14178-01 20 µL

KIF3A Polyclonal Antibody

Sign In for Pricing
View Details
KIF3A Polyclonal Antibody
E-AB-14178-02 60 µL

KIF3A Polyclonal Antibody

Sign In for Pricing
View Details