Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Stfa2 protein

This Mouse Stfa2 protein spans the amino acid sequence from region 1-103aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Stfa2, Stf-2, Stf2Stefin-2

UniProt

P35174

Expression Region

1-103aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTEYTRKIKGGLSEARPATSEIQEIADKVRPLLEEKTNEKYEKFKAIEYKVQVVQGLNYFIKMNVGRGCYLHINVLSGISSENDLELTGYQTNKAKNDELTYF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B-Myb (C-5) Alexa Fluor® 790
sc-390198 AF790 200 µg/mL

B-Myb (C-5) Alexa Fluor® 790

Sign In for Pricing
View Details
ML-323
2658-5 5 mg

ML-323

Sign In for Pricing
View Details
Rabbit Ring Finger Protein 112 (RNF112) ELISA Kit
abx363462 96 Well

Rabbit Ring Finger Protein 112 (RNF112) ELISA Kit

Sign In for Pricing
View Details
HnRNP K/J (3C2) Alexa Fluor® 594
sc-32307 AF594 200 µg/mL

HnRNP K/J (3C2) Alexa Fluor® 594

Sign In for Pricing
View Details
Recombinant Treponema Pallidum TP_0896 Protein (aa 1-50)
VAng-Cr1078-500gEcoli 500 µg (E. coli)

Recombinant Treponema Pallidum TP_0896 Protein (aa 1-50)

Sign In for Pricing
View Details
PTCH2 sgRNA CRISPR Lentivector (Human) (Target 1)
K1748702 1.0 µg DNA

PTCH2 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details