Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PLAU protein

This Human PLAU protein spans the amino acid sequence from region 21-431aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ATF, ATF uPA, BDPLT5, Plasminogen activator, Plasminogen activator urinary, Plasminogen activator urokinase, PLAU, QPD, u PA, U plasminogen activator, u-PA, U-plasminogen activator, uPA, URK, UROK_HUMAN, Urokinase plasminogen activator, Urokinase type plasminogen activator, Urokinase type plasminogen activator precursor, Urokinase-type plasminogen activator chain B

UniProt

P00749

Expression Region

21-431aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tetrahydrocannabivarin
CS-ED-01187 1 Each

Tetrahydrocannabivarin

Sign In for Pricing
View Details
Zfp574 ORF Vector (Rat) (pORF)
ORF079490 1.0 µg DNA

Zfp574 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Mouse Vomeronasal type-1 receptor 54 (VMN1R54) ELISA Kit
abx552799 96 Tests

Mouse Vomeronasal type-1 receptor 54 (VMN1R54) ELISA Kit

Sign In for Pricing
View Details
NKX2.8 (NKX28/3233R), 0.2mg/mL
BNUB3233-500 1x 500 µL

NKX2.8 (NKX28/3233R), 0.2mg/mL

Sign In for Pricing
View Details
Anti-OCT1/Slc22a1 Antibody Picoband® Fluoro550 Conjugated
A01945-1-Fluoro550 100 µg/Vial

Anti-OCT1/Slc22a1 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
STAT3 (NM_139276) Human Recombinant Protein
TP315836M 100 µg

STAT3 (NM_139276) Human Recombinant Protein

Sign In for Pricing
View Details