Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SLAMF6 protein

This Human SLAMF6 protein spans the amino acid sequence from region 22-226aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Activating NK receptor (NK-T-B-antigen) (NTB-A)

UniProt

Q96DU3

Expression Region

22-226aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E3 Ubiquitin-protein Ligase ipaH9.8, Recombinant, Shigella flexneri serotype X, aa1-545, His-Tag
584319-01 20 µg

E3 Ubiquitin-protein Ligase ipaH9.8, Recombinant, Shigella flexneri serotype X, aa1-545, His-Tag

Sign In for Pricing
View Details
E3 Ubiquitin-protein Ligase ipaH9.8, Recombinant, Shigella flexneri serotype X, aa1-545, His-Tag
584319-02 100 µg

E3 Ubiquitin-protein Ligase ipaH9.8, Recombinant, Shigella flexneri serotype X, aa1-545, His-Tag

Sign In for Pricing
View Details
S100A8/A9 Mouse Monoclonal Antibody [Clone 10F1]
E45M21585V-2 50 µL

S100A8/A9 Mouse Monoclonal Antibody [Clone 10F1]

Sign In for Pricing
View Details
Recombinant Human B7-2/CD86 (C-Avi-6His) Biotinylated
PKSH033999-01 20 µg

Recombinant Human B7-2/CD86 (C-Avi-6His) Biotinylated

Sign In for Pricing
View Details
Recombinant Human B7-2/CD86 (C-Avi-6His) Biotinylated
PKSH033999-02 100 µg

Recombinant Human B7-2/CD86 (C-Avi-6His) Biotinylated

Sign In for Pricing
View Details
HIF1 alpha (ARNT-interacting protein, Basic-helix-loop-helix-PAS protein MOP1, Class E basic helix-loop-helix protein 78 (bHLHe78), Hypoxia inducible factor 1 alpha, Member of PAS superfamily 1 (MOP1), PAS domain-containing protein 8 (PASD8) ) (BSA & Azide Free) (MaxLight 490)
168794-AF-ML490 100 µL

HIF1 alpha (ARNT-interacting protein, Basic-helix-loop-helix-PAS protein MOP1, Class E basic helix-loop-helix protein 78 (bHLHe78), Hypoxia inducible factor 1 alpha, Member of PAS superfamily 1 (MOP1), PAS domain-containing protein 8 (PASD8) ) (BSA & Azide Free) (MaxLight 490)

Sign In for Pricing
View Details