Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Canine hmfA protein

This Canine hmfA protein spans the amino acid sequence from region 1-69aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Archaeal histone A

UniProt

P48781

Expression Region

1-69aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Methanothermus fervidus

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGELPIAPIGRIIKNAGAERVSDDARIALAKVLEEMGEEIASEAVKLAKHAGRKTIKAEDIELARKMFK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kip2, p57 (cdk Inhibitor, Cyclin Dependent Kinase Inhibitor) (AP) discontinued
K1851-AP 100 µL

Kip2, p57 (cdk Inhibitor, Cyclin Dependent Kinase Inhibitor) (AP) discontinued

Sign In for Pricing
View Details
RSBN1L (NM_198467) Human Over-expression Lysate
LS222194-100ug 100 µg

RSBN1L (NM_198467) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti Human CD127/IL-7RA Flow Cytometry Monoclonal Clone A019D5 PE/Cyanine7 Ready To Use 100 Tests
IMSAHUCD127A019D5CPECY7100 100 Tests

Anti Human CD127/IL-7RA Flow Cytometry Monoclonal Clone A019D5 PE/Cyanine7 Ready To Use 100 Tests

Sign In for Pricing
View Details
Lentiviral mouse Ccdc86 shRNA (UAS) - Lentiviral mouse Ccdc86 shRNA (UAS, RFP) (100)
GTR15247740 1 Vial

Lentiviral mouse Ccdc86 shRNA (UAS) - Lentiviral mouse Ccdc86 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Anti-SARS-CoV-2 Spike+Nucleocapsid IgG+IgM, Humanized antibody (Positive Control)
MBS355909-01 1 mL

Anti-SARS-CoV-2 Spike+Nucleocapsid IgG+IgM, Humanized antibody (Positive Control)

Sign In for Pricing
View Details
Anti-SARS-CoV-2 Spike+Nucleocapsid IgG+IgM, Humanized antibody (Positive Control)
MBS355909-02 5x 1 mL

Anti-SARS-CoV-2 Spike+Nucleocapsid IgG+IgM, Humanized antibody (Positive Control)

Sign In for Pricing
View Details