Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TPP2 protein

This Human TPP2 protein spans the amino acid sequence from region 44-264aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tripeptidyl aminopeptidase (Tripeptidyl-peptidase II) (TPP-II)

UniProt

P29144

Expression Region

44-264aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DTGVDPGAPGMQVTTDGKPKIVDIIDTTGSGDVNTATEVEPKDGEIVGLSGRVLKIPASWTNPSGKYHIGIKNGYDFYPKALKERIQKERKEKIWDPVHRVALAEACRKQEEFDVANNGSSQANKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGEVWRACIDSNEDGDLSKSTVLRNYKEAQEYGSFGTAEMLNYSVNIYDDGNLLSIVTSGGAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC500331 Protein Lysate (Rat) with C-HA Tag
27286036 100 µg

LOC500331 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
NUP205 Protein Vector (Rat) (pPM-C-His)
PV286465 500 ng

NUP205 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Myostatin (MSTN, Growth Differentiation Factor 8, Growth/Differentiation Factor 8, GDF8, GDF-8) (HRP)
MBS6153676-01 0.1 mL

Myostatin (MSTN, Growth Differentiation Factor 8, Growth/Differentiation Factor 8, GDF8, GDF-8) (HRP)

Sign In for Pricing
View Details
Myostatin (MSTN, Growth Differentiation Factor 8, Growth/Differentiation Factor 8, GDF8, GDF-8) (HRP)
MBS6153676-02 5x 0.1 mL

Myostatin (MSTN, Growth Differentiation Factor 8, Growth/Differentiation Factor 8, GDF8, GDF-8) (HRP)

Sign In for Pricing
View Details
DAP3 (Death Associated Protein 3, DAP-3, DKFZp686G12159, MGC126058, MGC126059, MRP-S29, MRPS29, bMRP-10) (APC)
245187-APC 100 µL

DAP3 (Death Associated Protein 3, DAP-3, DKFZp686G12159, MGC126058, MGC126059, MRP-S29, MRPS29, bMRP-10) (APC)

Sign In for Pricing
View Details
BLUE AP Plus Staining Kit (Colorimetric)
NBP3-12171 30 mL

BLUE AP Plus Staining Kit (Colorimetric)

Sign In for Pricing
View Details