Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine RHO protein

This Bovine RHO protein spans the amino acid sequence from region 1-36aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RHO, Rhodopsin

UniProt

P02699

Expression Region

1-36aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Transmembrane protein 131-like, KIAA0922 ELISA Kit
MBS9323940-01 48 Well

Human Transmembrane protein 131-like, KIAA0922 ELISA Kit

Sign In for Pricing
View Details
Human Transmembrane protein 131-like, KIAA0922 ELISA Kit
MBS9323940-02 96 Well

Human Transmembrane protein 131-like, KIAA0922 ELISA Kit

Sign In for Pricing
View Details
Human Transmembrane protein 131-like, KIAA0922 ELISA Kit
MBS9323940-03 5x 96 Well

Human Transmembrane protein 131-like, KIAA0922 ELISA Kit

Sign In for Pricing
View Details
Human Transmembrane protein 131-like, KIAA0922 ELISA Kit
MBS9323940-04 10x 96 Well

Human Transmembrane protein 131-like, KIAA0922 ELISA Kit

Sign In for Pricing
View Details
RP11-298P3.3 Peptide - middle region
orb2009166 100 µg

RP11-298P3.3 Peptide - middle region

Sign In for Pricing
View Details
Anti-Annexin V Rabbit Monoclonal Antibody
MA1236-.05 50 µL

Anti-Annexin V Rabbit Monoclonal Antibody

Sign In for Pricing
View Details