Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine RHO protein

This Bovine RHO protein spans the amino acid sequence from region 1-36aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RHO, Rhodopsin

UniProt

P02699

Expression Region

1-36aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SLC26A8 shRNA (UAS) - Lentiviral human SLC26A8 shRNA (UAS, RFP) (25)
GTR15311438 1 Vial

Lentiviral human SLC26A8 shRNA (UAS) - Lentiviral human SLC26A8 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
ZDHHC14 (Probable palmitoyltransferase ZDHHC14, NEW1 Domain-Containing Protein, NEW1CP, Zinc Finger DHHC Domain-Containing Protein 14, DHHC-14, ZDHHC14) (MaxLight 405)
MBS6460391-01 0.1 mL

ZDHHC14 (Probable palmitoyltransferase ZDHHC14, NEW1 Domain-Containing Protein, NEW1CP, Zinc Finger DHHC Domain-Containing Protein 14, DHHC-14, ZDHHC14) (MaxLight 405)

Sign In for Pricing
View Details
ZDHHC14 (Probable palmitoyltransferase ZDHHC14, NEW1 Domain-Containing Protein, NEW1CP, Zinc Finger DHHC Domain-Containing Protein 14, DHHC-14, ZDHHC14) (MaxLight 405)
MBS6460391-02 5x 0.1 mL

ZDHHC14 (Probable palmitoyltransferase ZDHHC14, NEW1 Domain-Containing Protein, NEW1CP, Zinc Finger DHHC Domain-Containing Protein 14, DHHC-14, ZDHHC14) (MaxLight 405)

Sign In for Pricing
View Details
SRMS (N-term) Rabbit Polyclonal Antibody
AP14477PU-N 400 µL

SRMS (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ethyl Diphenylphosphinite
TRC-E937100-2.5G 2.5 g

Ethyl Diphenylphosphinite

Sign In for Pricing
View Details
FUT6, ID (FUT6, FCT3A, Alpha- (1,3) -fucosyltransferase, Fucosyltransferase 6, Fucosyltransferase VI, Galactoside 3-L-fucosyltransferase) (MaxLight 750) discontinued
035802-ML750 100 µL

FUT6, ID (FUT6, FCT3A, Alpha- (1,3) -fucosyltransferase, Fucosyltransferase 6, Fucosyltransferase VI, Galactoside 3-L-fucosyltransferase) (MaxLight 750) discontinued

Sign In for Pricing
View Details