Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine RHO protein

This Bovine RHO protein spans the amino acid sequence from region 1-36aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RHO, Rhodopsin

UniProt

P02699

Expression Region

1-36aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Tropomyosin(36/39 kDa) Tpm1 Antibody (Monoclonal, TM31), Carrier-free
MA1095-carrier-free 100 µg

Anti-Tropomyosin(36/39 kDa) Tpm1 Antibody (Monoclonal, TM31), Carrier-free

Sign In for Pricing
View Details
PanToxiLux™-P2D2
PTL804-8 80 Assays

PanToxiLux™-P2D2

Sign In for Pricing
View Details
GRASP1 (GRIPAP1) (NM_020137) Human Tagged Lenti ORF Clone
RC210936L1 10 µg

GRASP1 (GRIPAP1) (NM_020137) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
1-Cbz-Azetidine-3-CH2NH2
HY-W058001 100 mg

1-Cbz-Azetidine-3-CH2NH2

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Collagen Type VII (COL7)
MBS2109465-01 0.1 mL

PE-Linked Monoclonal Antibody to Collagen Type VII (COL7)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Collagen Type VII (COL7)
MBS2109465-02 0.2 mL

PE-Linked Monoclonal Antibody to Collagen Type VII (COL7)

Sign In for Pricing
View Details