Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Canine hmfB protein

This Canine hmfB protein spans the amino acid sequence from region 1-69aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Archaeal histone B

UniProt

P19267

Expression Region

1-69aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Methanothermus fervidus

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MELPIAPIGRIIKDAGAERVSDDARITLAKILEEMGRDIASEAIKLARHAGRKTIKAEDIELAVRRFKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Mcoln2 shRNA (UAS) - Lentiviral mouse Mcoln2 shRNA (UAS) plasmid
GTR15280735 1 Vial

Lentiviral mouse Mcoln2 shRNA (UAS) - Lentiviral mouse Mcoln2 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Protein Kinase Type II, Regulatory subunit (APC) discontinued
P9105-50-APC 100 µL

Protein Kinase Type II, Regulatory subunit (APC) discontinued

Sign In for Pricing
View Details
SOD1 discontinued
347658-01 100 µL

SOD1 discontinued

Sign In for Pricing
View Details
SOD1 discontinued
347658-02 200 µL

SOD1 discontinued

Sign In for Pricing
View Details
Human BNIP3 Pre-designed siRNA Set A
SI001622A 1 Each

Human BNIP3 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Corynebacterium efficiens 3-isopropylmalate dehydratase small subunit (leuD)
MBS1318491-01 0.02 mg (E-Coli)

Recombinant Corynebacterium efficiens 3-isopropylmalate dehydratase small subunit (leuD)

Sign In for Pricing
View Details