Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Canine hmfB protein

This Canine hmfB protein spans the amino acid sequence from region 1-69aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Archaeal histone B

UniProt

P19267

Expression Region

1-69aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Methanothermus fervidus

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MELPIAPIGRIIKDAGAERVSDDARITLAKILEEMGRDIASEAIKLARHAGRKTIKAEDIELAVRRFKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TriMethyl-Histone H4 Rabbit Monoclonal Antibody
E56G4080 100 µL

TriMethyl-Histone H4 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
PLCG1 Rabbit Polyclonal Antibody (Center)
E28PB5004 100 µL

PLCG1 Rabbit Polyclonal Antibody (Center)

Sign In for Pricing
View Details
Recombinant HCoV-229E S1 Protein (His Tag)
PKSV030116 100 µg

Recombinant HCoV-229E S1 Protein (His Tag)

Sign In for Pricing
View Details
NDUFC2 Adenovirus (Mouse)
31659054 1.0 mL

NDUFC2 Adenovirus (Mouse)

Sign In for Pricing
View Details
MTMR14 Antibody
orb679677 100 µL

MTMR14 Antibody

Sign In for Pricing
View Details
Recombinant human SLCO4C1 Protein, C-hFc & C-His (HEK293)
orb2328419-01 20 µg

Recombinant human SLCO4C1 Protein, C-hFc & C-His (HEK293)

Sign In for Pricing
View Details