Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Stc2 protein

This Mouse Stc2 protein spans the amino acid sequence from region 25-296aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Stc2, Stanniocalcin-2, STC-2

UniProt

O88452

Expression Region

25-296aa

Tag

Tag-Free

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TDSTNPPEGPQDRSSQQKGRLSLQNTAEIQHCLVNAGDVGCGVFECFENNSCEIQGLHGICMTFLHNAGKFDAQGKSFIKDALRCKAHALRHKFGCISRKCPAIREMVFQLQRECYLKHDLCSAAQENVGVIVEMIHFKDLLLHEPYVDLVNLLLTCGEDVKEAVTRSVQAQCEQSWGGLCSILSFCTSNIQRPPTAAPEHQPLADRAQLSRPHHRDTDHHLTANRGAKGERGSKSHPNAHARGRTGGQSAQGPSGSSEWEDEQSEYSDIRR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eg5 (KIF11) (NM_004523) Human Recombinant Protein
TP318842M 100 µg

Eg5 (KIF11) (NM_004523) Human Recombinant Protein

Sign In for Pricing
View Details
Human Brain Cancer (5 slides/pack, single section/slide)
S-HuCAT001 1 unit

Human Brain Cancer (5 slides/pack, single section/slide)

Sign In for Pricing
View Details
FAM117B Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
19730066 1.0 µg DNA

FAM117B Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
GLRX ELISA Kit (Mouse) (OKCD09018)
OKCD09018 96 Well

GLRX ELISA Kit (Mouse) (OKCD09018)

Sign In for Pricing
View Details
Control Normal Chicken IgY (HRP)
98-241 1 mL

Control Normal Chicken IgY (HRP)

Sign In for Pricing
View Details
DGKZ (NM_003646) Human Recombinant Protein
TP305327 20 µg

DGKZ (NM_003646) Human Recombinant Protein

Sign In for Pricing
View Details