Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Stc2 protein

This Mouse Stc2 protein spans the amino acid sequence from region 25-296aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Stc2, Stanniocalcin-2, STC-2

UniProt

O88452

Expression Region

25-296aa

Tag

Tag-Free

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TDSTNPPEGPQDRSSQQKGRLSLQNTAEIQHCLVNAGDVGCGVFECFENNSCEIQGLHGICMTFLHNAGKFDAQGKSFIKDALRCKAHALRHKFGCISRKCPAIREMVFQLQRECYLKHDLCSAAQENVGVIVEMIHFKDLLLHEPYVDLVNLLLTCGEDVKEAVTRSVQAQCEQSWGGLCSILSFCTSNIQRPPTAAPEHQPLADRAQLSRPHHRDTDHHLTANRGAKGERGSKSHPNAHARGRTGGQSAQGPSGSSEWEDEQSEYSDIRR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal GODZ Antibody [DyLight 550]
NBP3-06315R 0.1 mL

Rabbit Polyclonal GODZ Antibody [DyLight 550]

Sign In for Pricing
View Details
M-PEG-NHS ester (MW 30000)
orb3137891-01 50 mg

M-PEG-NHS ester (MW 30000)

Sign In for Pricing
View Details
M-PEG-NHS ester (MW 30000)
orb3137891-02 10 mg

M-PEG-NHS ester (MW 30000)

Sign In for Pricing
View Details
Rabbit Monoclonal S100P Antibody (S100P/7978R) [Alexa Fluor 405]
NBP3-20930AF405 0.1 mL

Rabbit Monoclonal S100P Antibody (S100P/7978R) [Alexa Fluor 405]

Sign In for Pricing
View Details
PCB (PC) (NM_000920) Human Over-expression Lysate
LC400340 20 µg

PCB (PC) (NM_000920) Human Over-expression Lysate

Sign In for Pricing
View Details
Plant Actin (HRP) discontinued
541129-01 50 µL

Plant Actin (HRP) discontinued

Sign In for Pricing
View Details