Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CCL5 protein

This Human CCL5 protein spans the amino acid sequence from region 24-91aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EoCPEosinophil chemotactic cytokine; SIS-delta; Small-inducible cytokine A5T cell-specific protein P228 ; TCP228T-cell-specific protein RANTES

UniProt

P13501

Expression Region

24-91aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBM26 Protein Vector (Mouse) (pPM-C-HA)
PV222868 500 ng

RBM26 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Orlistat Impurity 43
RM-O121943-01 10 mg

Orlistat Impurity 43

Sign In for Pricing
View Details
Orlistat Impurity 43
RM-O121943-02 25 mg

Orlistat Impurity 43

Sign In for Pricing
View Details
Orlistat Impurity 43
RM-O121943-03 50 mg

Orlistat Impurity 43

Sign In for Pricing
View Details
Orlistat Impurity 43
RM-O121943-04 100 mg

Orlistat Impurity 43

Sign In for Pricing
View Details
PAK1 peptide
orb339245-01 1 mg

PAK1 peptide

Sign In for Pricing
View Details