Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RPGR protein

This Human RPGR protein spans the amino acid sequence from region 54-367aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q92834

Expression Region

54-367aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

62.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NKLYMFGSNNWGQLGLGSKSAISKPTCVKALKPEKVKLAACGRNHTLVSTEGGNVYATGGNNEGQLGLGDTEERNTFHVISFFTSEHKIKQLSAGSNTSAALTEDGRLFMWGDNSEGQIGLKNVSNVCVPQQVTIGKPVSWISCGYYHSAFVTTDGELYVFGEPENGKLGLPNQLLGNHRTPQLVSEIPEKVIQVACGGEHTVVLTENAVYTFGLGQFGQLGLGTFLFETSEPKVIENIRDQTISYISCGENHTALITDIGLMYTFGDGRHGKLGLGLENFTNHFIPTLCSNFLRFIVKLVACGGCHMVVFAAP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

POU5F2 CRISPR Knock Out 293T Cell Line (Human)
37277141 1x 10^6 Cells / 1.0 mL

POU5F2 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Anti-Vaspin/SERPINA12 Antibody Picoband®, Dylight550 Conjugate
A05352-2-Dylight550 100 µg

Anti-Vaspin/SERPINA12 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
2- (2,3-Dihydro-1H-indol-1-yl) ethanimidamide hydrochloride
DXC59601-01 50 mg

2- (2,3-Dihydro-1H-indol-1-yl) ethanimidamide hydrochloride

Sign In for Pricing
View Details
2- (2,3-Dihydro-1H-indol-1-yl) ethanimidamide hydrochloride
DXC59601-02 0.5 g

2- (2,3-Dihydro-1H-indol-1-yl) ethanimidamide hydrochloride

Sign In for Pricing
View Details
BOCT shRNA (m) Lentiviral Particles
sc-141722-V 200 µL

BOCT shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Purified anti-human TNF-α
GT15637 100 µg

Purified anti-human TNF-α

Sign In for Pricing
View Details