Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TPSB2 protein

This Human TPSB2 protein spans the amino acid sequence from region 31-275aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tryptase II

UniProt

P20231

Expression Region

31-275aa

Tag

C-terminal 6xHis-Myc-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SERINC2 knockout cell line
ABC-KH13579 1 Vial

Human SERINC2 knockout cell line

Sign In for Pricing
View Details
P53 gene probe
FP-014-2 1 Vial 100 μL (10-20 T)

P53 gene probe

Sign In for Pricing
View Details
L-Tryptophan
GRM067-25G 1 unit

L-Tryptophan

Sign In for Pricing
View Details
KLRC1 Rabbit Polyclonal Antibody (HRP)
orb2096252 100 µL

KLRC1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Mouse Semaphorin-3F, Sema3f ELISA KIT
ELI-07282m 96 Tests

Mouse Semaphorin-3F, Sema3f ELISA KIT

Sign In for Pricing
View Details
pBluescriptR-DNAJB7 Plasmid
PVT28917 2 µg

pBluescriptR-DNAJB7 Plasmid

Sign In for Pricing
View Details