Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ISG15 protein

This Human ISG15 protein spans the amino acid sequence from region 2-157aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interferon-induced 15 kDa protein Interferon-induced 17 kDa protein Short name, IP17 Ubiquitin cross-reactive protein Short name, hUCRP

UniProt

P05161

Expression Region

2-157aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Vimentin Antibody (VM452) [mFluor Violet 500 SE]
NBP2-33060MFV500 0.1 mL

Mouse Monoclonal Vimentin Antibody (VM452) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Recombinant Mouse ADH7 Protein, His-SUMO, E.coli-50ug
QP7693-ec-50ug 50ug

Recombinant Mouse ADH7 Protein, His-SUMO, E.coli-50ug

Sign In for Pricing
View Details
C10orf28 3'UTR Luciferase Stable Cell Line
TU002662 1.0 mL

C10orf28 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
C3orf38 Recombinant Antibody, Cy3 Conjugated
bsm-62668R-Cy3 100 µL

C3orf38 Recombinant Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Njmu-R1 antibody
MBS9406053-01 0.1 mL

Njmu-R1 antibody

Sign In for Pricing
View Details
Njmu-R1 antibody
MBS9406053-02 5x 0.1 mL

Njmu-R1 antibody

Sign In for Pricing
View Details