Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine CSF2 protein

This Bovine CSF2 protein spans the amino acid sequence from region 18-143aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Colony-stimulating factor Short name, CSF

UniProt

P11052

Expression Region

18-143aa

Tag

C-terminal 6xHis-Myc-tagged

Source

Yeast

Origin

Bos taurus (Bovine)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APTRPPNTATRPWQHVDAIKEALSLLNHSSDTDAVMNDTEVVSEKFDSQEPTCLQTRLKLYKNGLQGSLTSLMGSLTMMATHYEKHCPPTPETSCGTQFISFKNFKEDLKEFLFIIPFDCWEPAQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Blonanserin Impurity 3
RM-B121429-01 10 mg

Blonanserin Impurity 3

Sign In for Pricing
View Details
Blonanserin Impurity 3
RM-B121429-02 25 mg

Blonanserin Impurity 3

Sign In for Pricing
View Details
Blonanserin Impurity 3
RM-B121429-03 50 mg

Blonanserin Impurity 3

Sign In for Pricing
View Details
Blonanserin Impurity 3
RM-B121429-04 100 mg

Blonanserin Impurity 3

Sign In for Pricing
View Details
RPRML Protein Vector (Rat) (pPB-N-His)
PV302375 500 ng

RPRML Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
ANKRD26 Protein Vector (Mouse) (pPM-C-His)
PV154545 500 ng

ANKRD26 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details