Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine CSF2 protein

This Bovine CSF2 protein spans the amino acid sequence from region 18-143aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Colony-stimulating factor Short name, CSF

UniProt

P11052

Expression Region

18-143aa

Tag

C-terminal 6xHis-Myc-tagged

Source

Yeast

Origin

Bos taurus (Bovine)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APTRPPNTATRPWQHVDAIKEALSLLNHSSDTDAVMNDTEVVSEKFDSQEPTCLQTRLKLYKNGLQGSLTSLMGSLTMMATHYEKHCPPTPETSCGTQFISFKNFKEDLKEFLFIIPFDCWEPAQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cloquintocet-1-methylhexyl ester
CS-EJ-00040 1 Each

Cloquintocet-1-methylhexyl ester

Sign In for Pricing
View Details
GSG1L Rabbit Polyclonal Antibody (AP)
orb945136 100 µL

GSG1L Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
GAPDH Mouse Monoclonal Antibody (AP)
orb968669 100 µL

GAPDH Mouse Monoclonal Antibody (AP)

Sign In for Pricing
View Details
SPG3A/ATL1 Rabbit Polyclonal Antibody (PE)
orb2597084 100 µg

SPG3A/ATL1 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
RNASE6 Antibody
DF15080-01 100 µL

RNASE6 Antibody

Sign In for Pricing
View Details
RNASE6 Antibody
DF15080-02 200 µL

RNASE6 Antibody

Sign In for Pricing
View Details