Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant COR410 protein

This Plant COR410 protein spans the amino acid sequence from region 1-262aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cold-induced COR410 protein

UniProt

P46524

Expression Region

1-262aa

Tag

C-terminal 6xHis-Myc-tagged

Source

Yeast

Origin

Triticum aestivum (Wheat)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEDERSTQSYQGGEAAEQVEVTDRGLLGNLLGKKKAEEDKEKEEELVTGMEKVSVEEPEVKKEEHEDGEKKETLFSKLHRSSSSSSSSSDEEEEEVIDDNGEVIKRKKKKGLKEKLQGKLPGHKDTEGEHVTGLPAPAAPASVQTHGGHHDTDVVVEKIDGDVKTEAAPAVPEEEKKGFLEKIKEKLPGGHKKPEDAAAVPVTHAAPAPVHAPVPAPEEVSSPDAKEKKGLLGKIMDKLPGYHKTGEEDKAAAATGEHKPSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PACAP (ADCYAP1) (NM_001117) Human Over-expression Lysate
LC400450 20 µg

PACAP (ADCYAP1) (NM_001117) Human Over-expression Lysate

Sign In for Pricing
View Details
EGFR (GFR1195), Biotin conjugate, 0.1mg/mL
BNCB1195-500 1x 500 µL

EGFR (GFR1195), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human RMI2 activation kit by CRISPRa
GA114557 1 Kit

Human RMI2 activation kit by CRISPRa

Sign In for Pricing
View Details
1,2-Dichloroethanol Acetate
TRC-D434615-250MG 250 mg

1,2-Dichloroethanol Acetate

Sign In for Pricing
View Details
PPP1R3A (NM_002711) Human Over-expression Lysate
LY419154 100 µg

PPP1R3A (NM_002711) Human Over-expression Lysate

Sign In for Pricing
View Details
OCT-2 (POU2F2) (B-Cell Marker) (OCT2/2137), 1mg/mL
BNUM2137-50 1x 50 µL

OCT-2 (POU2F2) (B-Cell Marker) (OCT2/2137), 1mg/mL

Sign In for Pricing
View Details