Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CDK5 protein

This Human CDK5 protein spans the amino acid sequence from region 1-292aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cell division protein kinase 5; Serine/threonine-protein kinase PSSALRE; Tau protein kinase II catalytic subunit; TPKII catalytic subunit

UniProt

Q00535

Expression Region

1-292aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCDNA3/HA-SUMO3 (Sentrin 2)
BZ23478 1 Vial

PCDNA3/HA-SUMO3 (Sentrin 2)

Sign In for Pricing
View Details
Cathepsin L (CTSL) Human Over-expression Lysate
orb1358455 100 µg

Cathepsin L (CTSL) Human Over-expression Lysate

Sign In for Pricing
View Details
1.7 Antibody
orb835362 2 mg

1.7 Antibody

Sign In for Pricing
View Details
CD21 antibody (PE)
MBS5318003-01 0.1 mg

CD21 antibody (PE)

Sign In for Pricing
View Details
CD21 antibody (PE)
MBS5318003-02 5x 0.1 mg

CD21 antibody (PE)

Sign In for Pricing
View Details
Human cluster Of differentiation, CD44 ELISA Kit
MBS700486-01 24 Well (LIMIT 1)

Human cluster Of differentiation, CD44 ELISA Kit

Sign In for Pricing
View Details