Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SIRPA protein

This Human SIRPA protein spans the amino acid sequence from region 1-131aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Brain Ig-like molecule with tyrosine-based activation motifs ; BitCD172 antigen-like family member AInhibitory receptor SHPS-1Macrophage fusion receptorMyD-1 antigen; Signal-regulatory protein alpha-1 ; Sirp-alpha-1Signal-regulatory protein alpha-2 ; Sirp-alpha-2Signal-regulatory protein alpha-3 ; Sirp-alpha-3p84; CD172a

UniProt

P78324

Expression Region

1-131aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPGRVLIYNQRQGPFPRVTTVSDTTKRNNMDFSIRIGNITPADAGTYYCIKFRKGSPDDVEFKSGAGTELSVRAKPVDGGFLGGGGCG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Nuclear Factor, Erythroid Derived 2, Like 2 (NFE2L2) ELISA Kit
orb1806931-01 48 Tests

Rat Nuclear Factor, Erythroid Derived 2, Like 2 (NFE2L2) ELISA Kit

Sign In for Pricing
View Details
Rat Nuclear Factor, Erythroid Derived 2, Like 2 (NFE2L2) ELISA Kit
orb1806931-02 96 Tests

Rat Nuclear Factor, Erythroid Derived 2, Like 2 (NFE2L2) ELISA Kit

Sign In for Pricing
View Details
Recombinant Clostridium thermocellum UPF0316 protein Cthe_2213 (Cthe_2213)
orb2929285-01 20 µg

Recombinant Clostridium thermocellum UPF0316 protein Cthe_2213 (Cthe_2213)

Sign In for Pricing
View Details
Recombinant Clostridium thermocellum UPF0316 protein Cthe_2213 (Cthe_2213)
orb2929285-02 100 µg

Recombinant Clostridium thermocellum UPF0316 protein Cthe_2213 (Cthe_2213)

Sign In for Pricing
View Details
Duck Interleukin 1, IL-1 ELISA Kit ALT name: IL-1apha; IL-1α
SL0005Du-01 48 Tests

Duck Interleukin 1, IL-1 ELISA Kit ALT name: IL-1apha; IL-1α

Sign In for Pricing
View Details
Duck Interleukin 1, IL-1 ELISA Kit ALT name: IL-1apha; IL-1α
SL0005Du-02 96 Tests

Duck Interleukin 1, IL-1 ELISA Kit ALT name: IL-1apha; IL-1α

Sign In for Pricing
View Details