Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CHRNB2 protein

This Human CHRNB2 protein spans the amino acid sequence from region 26-233aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P17787

Expression Region

26-233aa

Tag

N-terminal 10xHis-V5-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWDIVALPGRRNENPDDSTYVDITYDFIIRRK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEK5 Recombinant Antibody, Cy5 Conjugated
bsm-63027R-Cy5-TR 20 µL

MEK5 Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
O-Aminophenol Sulfate
TRC-A576865-100MG 100 mg

O-Aminophenol Sulfate

Sign In for Pricing
View Details
Receptor tyrosine-protein Kinase erbB-4 (ERBB4) Mouse ELISA Kit
G6855 96 Tests

Receptor tyrosine-protein Kinase erbB-4 (ERBB4) Mouse ELISA Kit

Sign In for Pricing
View Details
TPH2 Antibody [B20J2]
C20555-100uL 100 µL

TPH2 Antibody [B20J2]

Sign In for Pricing
View Details
Bufalin
S7821-25mg 25 mg

Bufalin

Sign In for Pricing
View Details
Mouse Host cell factor 2 Recombinant Protein N-6 His Tag
MBS8434120-01 0.05 mg

Mouse Host cell factor 2 Recombinant Protein N-6 His Tag

Sign In for Pricing
View Details