Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CELF1 protein

This Human CELF1 protein spans the amino acid sequence from region 1-482aa (T173E, S178D, S285D, S288D, S295D, S296D, S298D) . Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CELF-1;50 kDa nuclear polyadenylated RNA-binding protein; Bruno-like protein 2; CUG triplet repeat RNA-binding protein 1; CUG-BP1; CUG-BP- and ETR-3-like factor 1; Deadenylation factor CUG-BP; Embryo deadenylation element-binding protein homolog; EDEN-BP homolog; RNA-binding protein BRUNOL-2

UniProt

Q92879

Expression Region

1-482aa (T173E, S178D, S285D, S288D, S295D, S296D, S298D)

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRMLRGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQEMEGCDSPMVVKFADTQKDKEQKRMAQQLQQQMQQISAASVWGNLAGLNTLGPQYLALLQQTASSGNLNTLSSLHPMGGLNAMQLQNLAALAAAASAAQNTPSGTNALTTSSDPLDVLTSSGDDPDSSSSNSVNPIASLGALQTLAGATAGLNVGSLAGMAALNGGLGSSGLSNGTGSTMEALTQAYSGIQQYAAAALPTLYNQNLLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKNDSKPY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lpar3 Mouse Gene Knockout Kit (CRISPR)
KN509383 1 Kit

Lpar3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
OR51A10P sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
35270111 3x 1.0 µg

OR51A10P sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS607565 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Rabbit Polyclonal ELMOD1 Antibody
NBP3-17246-100ul 100 µL

Rabbit Polyclonal ELMOD1 Antibody

Sign In for Pricing
View Details
TBCAP1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV786796 1.0 µg DNA

TBCAP1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
SLC27A6 Protein Vector (Human) (pPB-C-His)
PV038593 500 ng

SLC27A6 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details