Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rabbit INS protein

This Rabbit INS protein spans the amino acid sequence from region 25-54aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Insulin B chain; Insulin A chain

UniProt

P01311

Expression Region

25-54aa

Tag

Tag-Free

Source

E.coli

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

3.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FVNQHLCGSHLVEALYLVCGERGFFYTPKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Helicobacter pylori Protein CrcB homolog (crcB)
orb2921535-01 20 µg

Recombinant Helicobacter pylori Protein CrcB homolog (crcB)

Sign In for Pricing
View Details
Recombinant Helicobacter pylori Protein CrcB homolog (crcB)
orb2921535-02 100 µg

Recombinant Helicobacter pylori Protein CrcB homolog (crcB)

Sign In for Pricing
View Details
Rat Monoclonal CX3CL1/Fractalkine Antibody (126315) [DyLight 680]
FAB571Y 0.1 mL

Rat Monoclonal CX3CL1/Fractalkine Antibody (126315) [DyLight 680]

Sign In for Pricing
View Details
OKCD02343-96W - ADCY10 ELISA Kit (Mouse)
OKCD02343-96W 96 Well

OKCD02343-96W - ADCY10 ELISA Kit (Mouse)

Sign In for Pricing
View Details
ACK1, Active Human Recombinant Protein
GWB-D2EC8D 10 µg

ACK1, Active Human Recombinant Protein

Sign In for Pricing
View Details
Mouse Fatty Acid Binding Protein 3, Muscle And Heart (FABP3) ELISA Kit
JL27209-01 48 Tests

Mouse Fatty Acid Binding Protein 3, Muscle And Heart (FABP3) ELISA Kit

Sign In for Pricing
View Details