Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rabbit INS protein

This Rabbit INS protein spans the amino acid sequence from region 25-54aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Insulin B chain; Insulin A chain

UniProt

P01311

Expression Region

25-54aa

Tag

Tag-Free

Source

E.coli

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

3.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FVNQHLCGSHLVEALYLVCGERGFFYTPKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Toll-like receptor 4 (TLR4) ELISA Kit
KTE60314-01 48 Tests

Human Toll-like receptor 4 (TLR4) ELISA Kit

Sign In for Pricing
View Details
Human Toll-like receptor 4 (TLR4) ELISA Kit
KTE60314-02 96 Tests

Human Toll-like receptor 4 (TLR4) ELISA Kit

Sign In for Pricing
View Details
Human Toll-like receptor 4 (TLR4) ELISA Kit
KTE60314-03 5x 96 Tests

Human Toll-like receptor 4 (TLR4) ELISA Kit

Sign In for Pricing
View Details
Human Toll-like receptor 4 (TLR4) ELISA Kit
KTE60314-04 50x 96 Tests

Human Toll-like receptor 4 (TLR4) ELISA Kit

Sign In for Pricing
View Details
GADL1 CRISPR Activation Plasmid (m2)
sc-428641-ACT-2 20 µg

GADL1 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
PAPSS2, NT (PAPS Synthase 2, PAPSS 2, 3'-phosphoadenosine 5'-phosphosulfate Synthase 2, ATPSK2, Bifunctional 3'-phosphoadenosine 5'-phosphosulfate Synthase 2, Sulfurylase Kinase 2, SK 2, SK2) (FITC) discontinued
P3105-59W-FITC 200 µL

PAPSS2, NT (PAPS Synthase 2, PAPSS 2, 3'-phosphoadenosine 5'-phosphosulfate Synthase 2, ATPSK2, Bifunctional 3'-phosphoadenosine 5'-phosphosulfate Synthase 2, Sulfurylase Kinase 2, SK 2, SK2) (FITC) discontinued

Sign In for Pricing
View Details