Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PpdK protein

This ppdK protein spans the amino acid sequence from region 384-511aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pyruvate, orthophosphate dikinase

UniProt

P22983

Expression Region

384-511aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Clostridium symbiosum (Bacteroides symbiosus)

Field of Research

Epigenetics, Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AALKAGEVIGSALPASPGAAAGKVYFTADEAKAAHEKGERVILVRLETSPEDIEGMHAAEGILTVRGGMTSHAAVVARGMGTCCVSGCGEIKINEEAKTFELGGHTFAEGDYISLDGSTGKIYKGDIE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cavy Protein BTG2 (BTG2) ELISA Kit
MBS9926255 Inquire

Cavy Protein BTG2 (BTG2) ELISA Kit

Sign In for Pricing
View Details
GSK3B CRISPR All-in-one AAV vector set (with saCas9)(Rat)
22736156 3x 1.0 µg DNA

GSK3B CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
1- (2,2,2-Trifluoroethyl) naphthalene
PC49554 1 Each

1- (2,2,2-Trifluoroethyl) naphthalene

Sign In for Pricing
View Details
Glt6d1 3'UTR GFP Stable Cell Line
TU255169 1.0 mL

Glt6d1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Duck Sodium Channel Protein Type 10 Subunit Alpha (SCN10A) ELISA Kit
MBS9351153 Inquire

Duck Sodium Channel Protein Type 10 Subunit Alpha (SCN10A) ELISA Kit

Sign In for Pricing
View Details
CD97 Rabbit pAb, Pacific Blue conjugated
orb2891152 100 µL

CD97 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details