Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NblA protein

This nblA protein spans the amino acid sequence from region 1-59aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P35087

Expression Region

1-59aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Synechococcus elongatus (strain PCC 7942 / FACHB-805) (Anacystis nidulans R2)

Field of Research

Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLPPLPDFSLSVEQQFDLQKYRQQVRDISREDLEDLFIEVVRQKMAHENIFKGMIRQGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chorionic Gonadotropin, Human (hCG) discontinued
C5069-10D 1 mg

Chorionic Gonadotropin, Human (hCG) discontinued

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD41 Antibody
JOT20991F 20Tests

PE/Cyanine5 Anti-Human CD41 Antibody

Sign In for Pricing
View Details
Human Phospholipase A2 Receptor 1,PLA2R1 ELISA KIT
JOT-EK2527Hu-01 48 Well

Human Phospholipase A2 Receptor 1,PLA2R1 ELISA KIT

Sign In for Pricing
View Details
Human Phospholipase A2 Receptor 1,PLA2R1 ELISA KIT
JOT-EK2527Hu-02 96 Well

Human Phospholipase A2 Receptor 1,PLA2R1 ELISA KIT

Sign In for Pricing
View Details
Heat Shock Protein 90a (HSP90 alpha, HSP86) (BSA & Azide Free) (PE) discontinued
H1832-81X-PE 100 µL

Heat Shock Protein 90a (HSP90 alpha, HSP86) (BSA & Azide Free) (PE) discontinued

Sign In for Pricing
View Details
5-Iodo-1H-pyrrolo[2,3-b]pyridine
MBS9025431-01 1 g

5-Iodo-1H-pyrrolo[2,3-b]pyridine

Sign In for Pricing
View Details