Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BARF1 protein

This BARF1 protein spans the amino acid sequence from region 21-221aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

33 kDa early protein p33

UniProt

P03228

Expression Region

21-221aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VTAFLGERVTLTSYWRRVSLGPEIEVSWFKLGPGEEQVLIGRMHHDVIFIEWPFRGFFDIHRSANTFFLVVTAANISHDGNYLCRMKLGETEVTKQEHLSVVKPLTLSVHSERSQFPDFSVLTVTCTVNAFPHPHVQWLMPEGVEPAPTAANGGVMKEKDGSLSVAVDLSLPKPWHLPVTCVGKNDKEEAHGVYVSGYLSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Parg shRNA (UAS) - Lentiviral mouse Parg shRNA (UAS, GFP) plasmid
GTR15278218 1 Vial

Lentiviral mouse Parg shRNA (UAS) - Lentiviral mouse Parg shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Phospho-NFKB p65 (Thr505) Rabbit Polyclonal Antibody (BF594)
orb1604121 100 µL

Phospho-NFKB p65 (Thr505) Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Lentiviral mouse Uts2b shRNA (UAS) - Lentiviral mouse Uts2b shRNA (UAS) plasmid
GTR15227143 1 Vial

Lentiviral mouse Uts2b shRNA (UAS) - Lentiviral mouse Uts2b shRNA (UAS) plasmid

Sign In for Pricing
View Details
Bis (2,2,2-Trifluoroethyl) Sulfate
RG-A261805-01 10 mg

Bis (2,2,2-Trifluoroethyl) Sulfate

Sign In for Pricing
View Details
Bis (2,2,2-Trifluoroethyl) Sulfate
RG-A261805-02 25 mg

Bis (2,2,2-Trifluoroethyl) Sulfate

Sign In for Pricing
View Details
Bis (2,2,2-Trifluoroethyl) Sulfate
RG-A261805-03 50 mg

Bis (2,2,2-Trifluoroethyl) Sulfate

Sign In for Pricing
View Details