Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HLA-DRB1 protein

This Human HLA-DRB1 protein spans the amino acid sequence from region 31-266aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Human leukocyte antigen DRB1; HLA-DRB1

UniProt

P01912

Expression Region

31-266aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DTRPRFLEYSTSECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAVTELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGVVESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPRGFLS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

APS (Adaptor Protein with Pleckstrin Homology and Src Homology 2 Domains, SH2 and PH Domain-containing Adapter Protein APS, SH2B Adapter Protein 2, SH2B2) (MaxLight 490) discontinued
A2500-02-ML490 100 µL

APS (Adaptor Protein with Pleckstrin Homology and Src Homology 2 Domains, SH2 and PH Domain-containing Adapter Protein APS, SH2B Adapter Protein 2, SH2B2) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Hsa-miR-6859-5p mimic
HY-R02281-01 5 nmol

Hsa-miR-6859-5p mimic

Sign In for Pricing
View Details
Hsa-miR-6859-5p mimic
HY-R02281-02 20 nmol

Hsa-miR-6859-5p mimic

Sign In for Pricing
View Details
Canine Calcium-binding mitochondrial carrier protein SCaMC-2 (SLC25A25) ELISA Kit
MBS7247246-01 48 Well

Canine Calcium-binding mitochondrial carrier protein SCaMC-2 (SLC25A25) ELISA Kit

Sign In for Pricing
View Details
Canine Calcium-binding mitochondrial carrier protein SCaMC-2 (SLC25A25) ELISA Kit
MBS7247246-02 96 Well

Canine Calcium-binding mitochondrial carrier protein SCaMC-2 (SLC25A25) ELISA Kit

Sign In for Pricing
View Details
Canine Calcium-binding mitochondrial carrier protein SCaMC-2 (SLC25A25) ELISA Kit
MBS7247246-03 5x 96 Well

Canine Calcium-binding mitochondrial carrier protein SCaMC-2 (SLC25A25) ELISA Kit

Sign In for Pricing
View Details