Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Echs1 protein

This Mouse Echs1 protein spans the amino acid sequence from region 28-290aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Enoyl-CoA hydratase 1 (Short-chain enoyl-CoA hydratase) (SCEH)

UniProt

Q8BH95

Expression Region

28-290aa

Tag

N-terminal 10xHis-tagged

Source

Baculovirus

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ASGANFQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEQDPAVGAIVLTGGDKAFAAGADIKEMQNRTFQDCYSSKFLSHWDHITRVKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVEKLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGNKLEKRLFYSTFATDDRREGMTAFVEKRKANFKDH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse CHURC1 Protein, His (Fc)-Avi-tagged
CHURC1-1683M 50 µg

Recombinant Mouse CHURC1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
TRAF1 Recombinant Protein
OPCD00238-10UG 10 µg

TRAF1 Recombinant Protein

Sign In for Pricing
View Details
Anti-Calnexin Antibody
90007-1 100 µg

Anti-Calnexin Antibody

Sign In for Pricing
View Details
CLCA2 sgRNA CRISPR Lentivector set (Human)
K0005601 3x 1.0 µg

CLCA2 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Lentiviral mouse Ubr4 shRNA (UAS) - Lentiviral mouse Ubr4 shRNA (UAS, RFP) (25)
GTR15248603 1 Vial

Lentiviral mouse Ubr4 shRNA (UAS) - Lentiviral mouse Ubr4 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
CXorf30 Rabbit Polyclonal Antibody
orb326958 100 µL

CXorf30 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details