Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Sost protein

This Mouse Sost protein spans the amino acid sequence from region 24-211aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q99P68

Expression Region

24-211aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QGWQAFRNDATEVIPGLGEYPEPPPENNQTMNRAENGGRPPHHPYDAKDVSEYSCRELHYTRFLTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPGARGAKANQAELENAY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal COL20A1 Antibody
NBP2-13855-25ul 25 µL

Rabbit Polyclonal COL20A1 Antibody

Sign In for Pricing
View Details
Donkey NT-3 Growth Factor Receptor (NTRK3) ELISA Kit
MBS9925679 Inquire

Donkey NT-3 Growth Factor Receptor (NTRK3) ELISA Kit

Sign In for Pricing
View Details
Otamixaban
A3690-100 100 mg

Otamixaban

Sign In for Pricing
View Details
Dihydronarwedine-d3
sc-498939 1 mg

Dihydronarwedine-d3

Sign In for Pricing
View Details
SCARA3 Polyclonal Antibody, HRP Conjugated
A65223-100 100 µL

SCARA3 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
SAT2 Antibody (YA8476, Mouse)
HY-P88792 1 Each

SAT2 Antibody (YA8476, Mouse)

Sign In for Pricing
View Details