Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Bcan protein

This Rat Bcan protein spans the amino acid sequence from region 658-786aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Brain-enriched hyaluronan-binding protein Short name, BEHAB

UniProt

P55068

Expression Region

658-786aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Rattus norvegicus (Rat)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DVGLHFCSPGWEPFQGACYKHFSTRRSWEEAESQCRALGAHLTSICTPEEQDFVNDRYREYQWIGLNDRTIEGDFLWSDGPPLLYENWNPGQPDSYFLSGENCVVMVWHDQGQWSDVPCNYHLSYTCKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PRKAB1 Protein, N-GST
AP93139 50 µg

Recombinant Human PRKAB1 Protein, N-GST

Sign In for Pricing
View Details
EAP30 Double Nickase Plasmid (h)
sc-406312-NIC 20 µg

EAP30 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Bpifa6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4321907 1.0 µg DNA

Bpifa6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
H3.3A (H3F3A) (NM_002107) Human Recombinant Protein
E45H32146E1 50 µg

H3.3A (H3F3A) (NM_002107) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse Monoclonal JAM-A Antibody (654806) [PE]
FAB1103P 0.1 mL

Mouse Monoclonal JAM-A Antibody (654806) [PE]

Sign In for Pricing
View Details
Mouse Monoclonal KIF2C Antibody (KIF2C/6525) [DyLight 405]
NBP3-21101V 0.1 mL

Mouse Monoclonal KIF2C Antibody (KIF2C/6525) [DyLight 405]

Sign In for Pricing
View Details